ARHGEF19 Antikörper

Produktnummer ABIN633111

Der Kaninchen Polyklonal anti-ARHGEF19 Antikörper (ABIN633111) detektiert spezifisch ARHGEF19 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für ARHGEF19 Antikörper (ABIN633111)

Target: ARHGEF19 (rho Guanine Nucleotide Exchange Factor (GEF) 19 (ARHGEF19))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ARHGEF19 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ARHGEF19 Antikörper

Aufreinigung: Affinity purified

Immunogen: ARHGEF19 antibody was raised using a synthetic peptide corresponding to a region with amino acids RFLLNSVLYQEYSDVASARELRRQQREEEGPGDEAEGAEEGPGPPRANLS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ARHGEF19 Blocking Peptide, (ABIN5612151), is also available for use as a blocking control in assays to test for specificity of this ARHGEF19 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARHGEF19 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ARHGEF19

Target: ARHGEF19 (rho Guanine Nucleotide Exchange Factor (GEF) 19 (ARHGEF19))

Andere Bezeichnung: ARHGEF19

Hintergrund: Guanine nucleotide exchange factors (GEFs) such as ARHGEF19 accelerate the GTPase activity of Rho GTPases.

Molekulargewicht: 89 kDa (MW of target protein)