AP1m2 Antikörper (N-Term)

Produktnummer ABIN633108

Produktdetails anti-AP1m2 Antikörper

Target: AP1m2 (Adaptor-Related Protein Complex 1, mu 2 Subunit (AP1m2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AP1m2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: AP1 M2 antibody was raised against the N terminal of AP1 2

Aufreinigung: Affinity purified

Immunogen: AP1 M2 antibody was raised using the N terminal of AP1 2 corresponding to a region with amino acids MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AP1M2 Blocking Peptide, catalog no. 33R-6400, is also available for use as a blocking control in assays to test for specificity of this AP1M2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AP0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AP1m2

Target: AP1m2 (Adaptor-Related Protein Complex 1, mu 2 Subunit (AP1m2))

Andere Bezeichnung: AP1M2 (AP1m2 Produkte)

Synonyme: Ap1m1 antikoerper, zgc:103537 antikoerper, D9Ertd818e antikoerper, [m]1B antikoerper, mu1B antikoerper, AP1-mu2 antikoerper, HSMU1B antikoerper, MU-1B antikoerper, MU1B antikoerper, mu2 antikoerper, adaptor-related protein complex 1, mu 2 subunit antikoerper, adaptor related protein complex 1 mu 2 subunit antikoerper, adaptor protein complex AP-1, mu 2 subunit antikoerper, ap1m2 antikoerper, AP1M2 antikoerper, Ap1m2 antikoerper

Hintergrund: This gene encodes a subunit of the heterotetrameric adaptor-related protein comlex 1 (AP-1), which belongs to the adaptor complexes medium subunits family. This protein is capable of interacting with tyrosine-based sorting signals.

Molekulargewicht: 48 kDa (MW of target protein)