AP1m2 Antikörper (N-Term)

Produktnummer ABIN633108

Dieses Anti-AP1m2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von AP1m2 in WB. Geeignet für Human.

Kurzübersicht für AP1m2 Antikörper (N-Term) (ABIN633108)

Target: AP1m2 (Adaptor-Related Protein Complex 1, mu 2 Subunit (AP1m2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AP1m2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-AP1m2 Antikörper

Bindungsspezifität: N-Term

Spezifität: AP1 M2 antibody was raised against the N terminal of AP1 2

Aufreinigung: Affinity purified

Immunogen: AP1 M2 antibody was raised using the N terminal of AP1 2 corresponding to a region with amino acids MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AP1M2 Blocking Peptide, (ABIN5612094), is also available for use as a blocking control in assays to test for specificity of this AP1M2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AP0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AP1m2

Target: AP1m2 (Adaptor-Related Protein Complex 1, mu 2 Subunit (AP1m2))

Andere Bezeichnung: AP1M2

Hintergrund: This gene encodes a subunit of the heterotetrameric adaptor-related protein comlex 1 (AP-1), which belongs to the adaptor complexes medium subunits family. This protein is capable of interacting with tyrosine-based sorting signals.

Molekulargewicht: 48 kDa (MW of target protein)