Otospiralin Antikörper (N-Term)

Produktnummer ABIN633104

Produktdetails anti-Otospiralin Antikörper

Target: Otospiralin (OTOS)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Otospiralin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Otospiralin antibody was raised against the N terminal of OTOS

Aufreinigung: Affinity purified

Immunogen: Otospiralin antibody was raised using the N terminal of OTOS corresponding to a region with amino acids MQACMVPGLALCLLLGPLAGAKPVQEEGDPYAELPAMPYWPFSTSDFWNY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Otospiralin Blocking Peptide, catalog no. 33R-6316, is also available for use as a blocking control in assays to test for specificity of this Otospiralin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OTOS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Otospiralin

Target: Otospiralin (OTOS)

Andere Bezeichnung: Otospiralin (OTOS Produkte)

Synonyme: otosb antikoerper, otosp antikoerper, MGC85248 antikoerper, otos antikoerper, otosa antikoerper, MGC148549 antikoerper, OTOSP antikoerper, otospiralin L homeolog antikoerper, otospiralin antikoerper, otospiralin S homeolog antikoerper, otos.L antikoerper, OTOS antikoerper, otos.S antikoerper, otos antikoerper, Otos antikoerper

Hintergrund: OTOS may be essential for the survival of the neurosensory epithelium of the inner ear.

Molekulargewicht: 10 kDa (MW of target protein)

Pathways: Sensory Perception of Sound