COX7B Antikörper (N-Term)

Produktnummer ABIN633101

Der Kaninchen Polyklonal Anti-COX7B-Antikörper wurde für WB validiert. Er ist geeignet, COX7B in Proben von Human zu detektieren.

Kurzübersicht für COX7B Antikörper (N-Term) (ABIN633101)

Target: COX7B (Cytochrome C Oxidase Subunit VIIb (COX7B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser COX7B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-COX7B Antikörper

Bindungsspezifität: N-Term

Spezifität: COX7 B antibody was raised against the N terminal of COX7

Aufreinigung: Affinity purified

Immunogen: COX7 B antibody was raised using the N terminal of COX7 corresponding to a region with amino acids MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

COX7B Blocking Peptide, (ABIN5612977), is also available for use as a blocking control in assays to test for specificity of this COX7B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COX0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu COX7B

Target: COX7B (Cytochrome C Oxidase Subunit VIIb (COX7B))

Andere Bezeichnung: COX7B

Hintergrund: Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes subunit VIIb, which is highly similar to bovine COX VIIb protein and is found in all tissues. This gene may have several pseudogenes on chromosomes 1, 2, 20 and 22, respectively.

Molekulargewicht: 6 kDa (MW of target protein)

Pathways: Proton Transport