CRP Antikörper (N-Term)

Produktnummer ABIN633100

Produktdetails anti-CRP Antikörper

Target: CRP (C-Reactive Protein (CRP))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CRP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CRP antibody was raised against the N terminal of CRP

Aufreinigung: Affinity purified

Immunogen: CRP antibody was raised using the N terminal of CRP corresponding to a region with amino acids MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CRP Blocking Peptide, catalog no. 33R-5929, is also available for use as a blocking control in assays to test for specificity of this CRP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CRP

Target: CRP (C-Reactive Protein (CRP))

Andere Bezeichnung: C-Reactive Protein (CRP Produkte)

Synonyme: PTX1 antikoerper, crp antikoerper, AI255847 antikoerper, Aa1249 antikoerper, Ab1-341 antikoerper, Ab2-196 antikoerper, Ac1-114 antikoerper, Ac1262 antikoerper, Ac2-069 antikoerper, Ba2-693 antikoerper, APCS antikoerper, 0610010I23Rik antikoerper, AW743261 antikoerper, C77570 antikoerper, CRP2 antikoerper, CRP4 antikoerper, Crp antikoerper, ESP1 antikoerper, Hlp antikoerper, CRP5.1 antikoerper, zgc:152809 antikoerper, C-reactive protein antikoerper, C-reactive protein, pentraxin-related antikoerper, c-reactive protein, pentraxin-related antikoerper, cysteine rich protein 2 antikoerper, CRP antikoerper, crp antikoerper, Crp antikoerper, Crip2 antikoerper, LOC776376 antikoerper

Hintergrund: The protein encoded by this gene belongs to the pentaxin family. It is involved in several host defense related functions based on its ability to recognise foreign pathogens and damaged cells of the host and to initiate their elimination by interacting with humoral and cellular effector systems in the blood. Consequently, the level of this protein in plasma increases greatly during acute phase response to tissue injury, infection, or other inflammatory stimuli.

Molekulargewicht: 25 kDa (MW of target protein)

Pathways: Carbohydrate Homeostasis