CRP Antikörper (N-Term)

Produktnummer ABIN633100

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch CRP in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für CRP Antikörper (N-Term) (ABIN633100)

Target: CRP (C-Reactive Protein (CRP))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CRP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CRP Antikörper

Bindungsspezifität: N-Term

Spezifität: CRP antibody was raised against the N terminal of CRP

Aufreinigung: Affinity purified

Immunogen: CRP antibody was raised using the N terminal of CRP corresponding to a region with amino acids MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CRP Blocking Peptide, (ABIN5613007), is also available for use as a blocking control in assays to test for specificity of this CRP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CRP

Target: CRP (C-Reactive Protein (CRP))

Andere Bezeichnung: C-Reactive Protein

Hintergrund: The protein encoded by this gene belongs to the pentaxin family. It is involved in several host defense related functions based on its ability to recognise foreign pathogens and damaged cells of the host and to initiate their elimination by interacting with humoral and cellular effector systems in the blood. Consequently, the level of this protein in plasma increases greatly during acute phase response to tissue injury, infection, or other inflammatory stimuli.

Molekulargewicht: 25 kDa (MW of target protein)

Pathways: Carbohydrate Homeostasis