FTO Antikörper (Middle Region)

Produktnummer ABIN633096

Dieses Anti-FTO-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von FTO in WB. Geeignet für Human.

Kurzübersicht für FTO Antikörper (Middle Region) (ABIN633096)

Target: FTO (Fat Mass and Obesity-Associated (FTO))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FTO Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FTO Antikörper

Bindungsspezifität: Middle Region

Spezifität: FTO antibody was raised against the middle region of FTO

Aufreinigung: Affinity purified

Immunogen: FTO antibody was raised using the middle region of FTO corresponding to a region with amino acids WWCQPMAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FTO Blocking Peptide, (ABIN935992), is also available for use as a blocking control in assays to test for specificity of this FTO antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FTO antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FTO

Target: FTO (Fat Mass and Obesity-Associated (FTO))

Andere Bezeichnung: FTO

Hintergrund: The exact function of this gene is not known. Studies in mice suggest that it may be involved in nucleic acid demethylation, and that its mRNA level is regulated by feeding and fasting. Genomewide association studies of type 2 diabetes indicate this gene as a diabetes susceptibility locus. Mutation in this gene has been associated with growth retardation, developmental delay, coarse facies, and early death.

Molekulargewicht: 58 kDa (MW of target protein)