CCDC76 Antikörper (N-Term)

Produktnummer ABIN633095

Produktdetails anti-CCDC76 Antikörper

Target: CCDC76 (Coiled-Coil Domain Containing 76 (CCDC76))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CCDC76 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CCDC76 antibody was raised against the N terminal of CCDC76

Aufreinigung: Affinity purified

Immunogen: CCDC76 antibody was raised using the N terminal of CCDC76 corresponding to a region with amino acids QLAKHLKKCNSREKPKPDFYIQDINAGLRDETEIPEQLVPISSLSEEQLE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CCDC76 Blocking Peptide, catalog no. 33R-7618, is also available for use as a blocking control in assays to test for specificity of this CCDC76 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC76 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CCDC76

Target: CCDC76 (Coiled-Coil Domain Containing 76 (CCDC76))

Andere Bezeichnung: CCDC76 (CCDC76 Produkte)

Synonyme: 4631408H19Rik antikoerper, A330067P21 antikoerper, A930028L21Rik antikoerper, Ccdc76 antikoerper, CCDC76 antikoerper, tRNA methyltransferase 13 antikoerper, tRNA methyltransferase 13 homolog antikoerper, Trmt13 antikoerper, TRMT13 antikoerper

Hintergrund: CCDC76 specifically methylates guanosine-4 in various tRNAs with a Gly(CCG), His or Pro signature.

Molekulargewicht: 54 kDa (MW of target protein)