Neuronatin (NNAT) (Middle Region) Antikörper

Produktnummer ABIN633088

Produktdetails

Target: Neuronatin (NNAT)

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NNAT antibody was raised against the middle region of NNAT

Aufreinigung: Affinity purified

Immunogen: NNAT antibody was raised using the middle region of NNAT corresponding to a region with amino acids MAAVAAASAELLIIGWYIFRVLLQVFRYSLQKLAYTVSRTGRQVLGERRQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NNAT Blocking Peptide, catalog no. 33R-5614, is also available for use as a blocking control in assays to test for specificity of this NNAT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NNAT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Neuronatin (NNAT)

Andere Bezeichnung: NNAT (NNAT Produkte)

Synonyme: Peg5 antikoerper, 5730414I02Rik antikoerper, AW107673 antikoerper, neuronatin antikoerper, NNAT antikoerper, Nnat antikoerper

Hintergrund: The protein encoded by this gene is a proteolipid that may be involved in the regulation of ion channels during brain development. The encoded protein may also play a role in forming and maintaining the structure of the nervous system. This gene is found within an intron of the BLCAP gene, but on the opposite strand. This gene is imprinted and is expressed only from the paternal allele. Two transcript variants encoding two different isoforms have been found for this gene.

Molekulargewicht: 6 kDa (MW of target protein)

Pathways: Positive Regulation of Peptide Hormone Secretion