Neuronatin (NNAT) (Middle Region) Antikörper
-
- Target Alle Neuronatin (NNAT) Antikörper anzeigen
- Neuronatin (NNAT)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NNAT antibody was raised against the middle region of NNAT
- Aufreinigung
- Affinity purified
- Immunogen
- NNAT antibody was raised using the middle region of NNAT corresponding to a region with amino acids MAAVAAASAELLIIGWYIFRVLLQVFRYSLQKLAYTVSRTGRQVLGERRQ
- Top Product
- Discover our top product NNAT Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NNAT Blocking Peptide, catalog no. 33R-5614, is also available for use as a blocking control in assays to test for specificity of this NNAT antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NNAT antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Neuronatin (NNAT)
- Andere Bezeichnung
- NNAT (NNAT Produkte)
- Hintergrund
- The protein encoded by this gene is a proteolipid that may be involved in the regulation of ion channels during brain development. The encoded protein may also play a role in forming and maintaining the structure of the nervous system. This gene is found within an intron of the BLCAP gene, but on the opposite strand. This gene is imprinted and is expressed only from the paternal allele. Two transcript variants encoding two different isoforms have been found for this gene.
- Molekulargewicht
- 6 kDa (MW of target protein)
- Pathways
- Positive Regulation of Peptide Hormone Secretion
-