LRG1 Antikörper (N-Term)
-
- Target Alle LRG1 Antikörper anzeigen
- LRG1 (Leucine-Rich alpha-2 Glycoprotein 1 (LRG1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LRG1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LRG1 antibody was raised against the N terminal of LRG1
- Aufreinigung
- Affinity purified
- Immunogen
- LRG1 antibody was raised using the N terminal of LRG1 corresponding to a region with amino acids GVTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLP
- Top Product
- Discover our top product LRG1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LRG1 Blocking Peptide, catalog no. 33R-3657, is also available for use as a blocking control in assays to test for specificity of this LRG1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRG1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LRG1 (Leucine-Rich alpha-2 Glycoprotein 1 (LRG1))
- Andere Bezeichnung
- LRG1 (LRG1 Produkte)
- Synonyme
- lrg antikoerper, HMFT1766 antikoerper, LRG antikoerper, 1300008B03Rik antikoerper, 2310031E04Rik antikoerper, Lrg antikoerper, Lrhg antikoerper, si:dkey-90m5.4 antikoerper, leucine rich alpha-2-glycoprotein 1 antikoerper, leucine-rich alpha-2-glycoprotein 1 L homeolog antikoerper, leucine-rich alpha-2-glycoprotein 1 antikoerper, perilipin-5 antikoerper, si:dkey-90m5.4 antikoerper, LRG1 antikoerper, lrg1.L antikoerper, Lrg1 antikoerper, PLIN5 antikoerper
- Hintergrund
- The leucine-rich repeat (LRR) family of proteins, including LRG1, have been shown to be involved in protein-protein interaction, signal transduction, and cell adhesion and development. LRG1 is expressed during granulocyte differentiation.
- Molekulargewicht
- 38 kDa (MW of target protein)
- Pathways
- Brown Fat Cell Differentiation
-