LRG1 Antikörper (N-Term)

Produktnummer ABIN633085

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch LRG1 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für LRG1 Antikörper (N-Term) (ABIN633085)

Target: LRG1 (Leucine-Rich alpha-2 Glycoprotein 1 (LRG1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LRG1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LRG1 Antikörper

Bindungsspezifität: N-Term

Spezifität: LRG1 antibody was raised against the N terminal of LRG1

Aufreinigung: Affinity purified

Immunogen: LRG1 antibody was raised using the N terminal of LRG1 corresponding to a region with amino acids GVTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LRG1 Blocking Peptide, (ABIN939043), is also available for use as a blocking control in assays to test for specificity of this LRG1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRG1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LRG1

Target: LRG1 (Leucine-Rich alpha-2 Glycoprotein 1 (LRG1))

Andere Bezeichnung: LRG1

Hintergrund: The leucine-rich repeat (LRR) family of proteins, including LRG1, have been shown to be involved in protein-protein interaction, signal transduction, and cell adhesion and development. LRG1 is expressed during granulocyte differentiation.

Molekulargewicht: 38 kDa (MW of target protein)

Pathways: Brown Fat Cell Differentiation