Ensa Antikörper (N-Term)

Produktnummer ABIN633083

Produktdetails anti-Ensa Antikörper

Target: Ensa (ENSA) (Endosulfine alpha (ENSA))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Ensa Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ENSA antibody was raised against the N terminal of ENSA

Aufreinigung: Affinity purified

Immunogen: ENSA antibody was raised using the N terminal of ENSA corresponding to a region with amino acids MAGGLGCDVCYWFVEDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ENSA Blocking Peptide, catalog no. 33R-5662, is also available for use as a blocking control in assays to test for specificity of this ENSA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENSA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Ensa

Target: Ensa (ENSA) (Endosulfine alpha (ENSA))

Andere Bezeichnung: ENSA (ENSA Produkte)

Synonyme: ARPP-19e antikoerper, 1700020C18Rik antikoerper, 2610007F17Rik antikoerper, AI451924 antikoerper, ensa antikoerper, si:dkeyp-24a7.3 antikoerper, ensaa antikoerper, endosulfine alpha antikoerper, endosulfine alpha a antikoerper, endosulfine alpha S homeolog antikoerper, ENSA antikoerper, Ensa antikoerper, ensa antikoerper, ensaa antikoerper, ensa.S antikoerper

Hintergrund: The protein encoded by this gene belongs to a highly conserved cAMP-regulated phosphoprotein (ARPP) family. This protein was identified as an endogenous ligand for the sulfonylurea receptor, ABCC8/SUR1. ABCC8 is the regulatory subunit of the ATP-sensitive potassium (KATP) channel, which is located on the plasma membrane of pancreatic beta cells and plays a key role in the control of insulin release from pancreatic beta cells. This protein is thought to be an endogenous regulator of KATP channels. In vitro studies have demonstrated that this protein modulates insulin secretion through the interaction with KATP channel, and this gene has been proposed as a candidate gene for type 2 diabetes. At least eight alternatively spliced transcript variants encoding distinct isoforms have been observed.

Molekulargewicht: 12 kDa (MW of target protein)