RAB11FIP2 Antikörper

Produktnummer ABIN633082

Produktdetails anti-RAB11FIP2 Antikörper

Target: RAB11FIP2 (RAB11 Family Interacting Protein 2 (Class I) (RAB11FIP2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAB11FIP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: RAB11 FIP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLIQGSPEKYILFLIVMHRSLVGLDKFLGQVAINLNDIFEDKQRRKTEWF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAB11FIP2 Blocking Peptide, catalog no. 33R-5150, is also available for use as a blocking control in assays to test for specificity of this RAB11FIP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB10 IP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAB11FIP2

Target: RAB11FIP2 (RAB11 Family Interacting Protein 2 (Class I) (RAB11FIP2))

Andere Bezeichnung: RAB11FIP2 (RAB11FIP2 Produkte)

Synonyme: RGD1308538 antikoerper, Rab11-FIP2 antikoerper, nRip11 antikoerper, 4930470G04Rik antikoerper, A830046J09Rik antikoerper, AW558126 antikoerper, Nrip11 antikoerper, RAB11 family interacting protein 2 antikoerper, RAB11 family interacting protein 2 (class I) antikoerper, Rab11fip2 antikoerper, RAB11FIP2 antikoerper

Hintergrund: RAB11FIP2 is a Rab11 effector protein acting in the regulation of the transport of vesicles from the endosomal recycling compartment (ERC) to the plasma membrane.RAB11FIP2 is also involved in receptor-mediated endocytosis and membrane trafficking of recycling endosomes, probably originating from clathrin-coated vesicles. Binds preferentially to phosphatidylinositol 3,4,5-trisphosphate (PtdInsP3) and phosphatidic acid (PA).

Molekulargewicht: 58 kDa (MW of target protein)

Pathways: Hormone Transport, Carbohydrate Homeostasis