RABEPK Antikörper (N-Term)

Produktnummer ABIN633075

Dieses Anti-RABEPK-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von RABEPK in WB. Geeignet für Human.

Kurzübersicht für RABEPK Antikörper (N-Term) (ABIN633075)

Target: RABEPK (Rab9 Effector Protein with Kelch Motifs (RABEPK))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RABEPK Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RABEPK Antikörper

Bindungsspezifität: N-Term

Spezifität: RABEPK antibody was raised against the N terminal of RABEPK

Aufreinigung: Affinity purified

Immunogen: RABEPK antibody was raised using the N terminal of RABEPK corresponding to a region with amino acids MKQLPVLEPGDKPRKATWYTLTVPGDSPCARVGHSCSYLPPVGNAKRGKV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RABEPK Blocking Peptide, (ABIN5615720), is also available for use as a blocking control in assays to test for specificity of this RABEPK antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RABEPK antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RABEPK

Target: RABEPK (Rab9 Effector Protein with Kelch Motifs (RABEPK))

Andere Bezeichnung: RABEPK

Hintergrund: RABEPK is a rab9 effector required for endosome to trans-Golgi network (TGN) transport.

Molekulargewicht: 40 kDa (MW of target protein)