CPLX2 Antikörper (N-Term)

Produktnummer ABIN633073

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch CPLX2 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für CPLX2 Antikörper (N-Term) (ABIN633073)

Target: CPLX2 (Complexin 2 (CPLX2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CPLX2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CPLX2 Antikörper

Bindungsspezifität: N-Term

Spezifität: Complexin 2 antibody was raised against the N terminal of CPLX2

Aufreinigung: Affinity purified

Immunogen: Complexin 2 antibody was raised using the N terminal of CPLX2 corresponding to a region with amino acids MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Complexin 2 Blocking Peptide, (ABIN5612958), is also available for use as a blocking control in assays to test for specificity of this Complexin 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPLX2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CPLX2

Target: CPLX2 (Complexin 2 (CPLX2))

Andere Bezeichnung: Complexin 2

Hintergrund: Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis. These proteins bind syntaxin, part of the SNAP receptor. The protein product of this gene binds to the SNAP receptor complex and disrupts it, allowing transmitter release. Two transcript variants encoding the same protein have been found for this gene.

Molekulargewicht: 15 kDa (MW of target protein)

Pathways: Synaptic Vesicle Exocytosis