DNAJA2 Antikörper

Produktnummer ABIN633071

Der Kaninchen Polyklonal anti-DNAJA2 Antikörper wird verwendet zum Nachweis von DNAJA2 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für DNAJA2 Antikörper (ABIN633071)

Target: DNAJA2 (DnaJ (Hsp40) Homolog, Subfamily A, Member 2 (DNAJA2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DNAJA2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DNAJA2 Antikörper

Aufreinigung: Affinity purified

Immunogen: DNAJA2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YHPDKNPNAGDKFKEISFAYEVLSNPEKRELYDRYGEQGLREGSGGGGGM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DNAJA2 Blocking Peptide, (ABIN936091), is also available for use as a blocking control in assays to test for specificity of this DNAJA2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJA2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DNAJA2

Target: DNAJA2 (DnaJ (Hsp40) Homolog, Subfamily A, Member 2 (DNAJA2))

Andere Bezeichnung: DNAJA2

Hintergrund: The protein encoded by this gene belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the N terminus, a glycine/phenylalanine (G/F)-rich region, and a cysteine-rich domain containing 4 motifs resembling a zinc finger domain. The product of this gene works as a cochaperone of Hsp70s in protein folding and mitochondrial protein import in vitro.

Molekulargewicht: 46 kDa (MW of target protein)