TMPRSS4 Antikörper (Middle Region)

Produktnummer ABIN633060

Der Kaninchen Polyklonal anti-TMPRSS4 Antikörper (ABIN633060) detektiert spezifisch TMPRSS4 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für TMPRSS4 Antikörper (Middle Region) (ABIN633060)

Target: TMPRSS4 (Transmembrane Protease, serine 4 (TMPRSS4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMPRSS4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TMPRSS4 Antikörper

Bindungsspezifität: Middle Region

Spezifität: TMPRSS4 antibody was raised against the middle region of TMPRSS4

Aufreinigung: Affinity purified

Immunogen: TMPRSS4 antibody was raised using the middle region of TMPRSS4 corresponding to a region with amino acids LSGSLVSLHCLACGKSLKTPRVVGGEEASVDSWPWQVSIQYDKQHVCGGS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMPRSS4 Blocking Peptide, (ABIN5616697), is also available for use as a blocking control in assays to test for specificity of this TMPRSS4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMPRSS4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMPRSS4

Target: TMPRSS4 (Transmembrane Protease, serine 4 (TMPRSS4))

Andere Bezeichnung: TMPRSS4

Hintergrund: This gene encodes a member of the serine protease family. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified as a gene overexpressed in pancreatic carcinoma. The encoded protein is membrane bound with a N-terminal anchor sequence and a glycosylated extracellular region containing the serine protease domain. Multiple transcript variants encoding different isoforms have been found for this gene.

Molekulargewicht: 48 kDa (MW of target protein)