TMPRSS4 Antikörper (Middle Region)
-
- Target Alle TMPRSS4 Antikörper anzeigen
- TMPRSS4 (Transmembrane Protease, serine 4 (TMPRSS4))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TMPRSS4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TMPRSS4 antibody was raised against the middle region of TMPRSS4
- Aufreinigung
- Affinity purified
- Immunogen
- TMPRSS4 antibody was raised using the middle region of TMPRSS4 corresponding to a region with amino acids LSGSLVSLHCLACGKSLKTPRVVGGEEASVDSWPWQVSIQYDKQHVCGGS
- Top Product
- Discover our top product TMPRSS4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TMPRSS4 Blocking Peptide, catalog no. 33R-5428, is also available for use as a blocking control in assays to test for specificity of this TMPRSS4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMPRSS4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMPRSS4 (Transmembrane Protease, serine 4 (TMPRSS4))
- Andere Bezeichnung
- TMPRSS4 (TMPRSS4 Produkte)
- Synonyme
- tmprss4 antikoerper, zgc:152909 antikoerper, CAPH2 antikoerper, MT-SP2 antikoerper, TMPRSS3 antikoerper, mCAP2 antikoerper, transmembrane protease, serine 4 antikoerper, transmembrane protease, serine 4a antikoerper, TMPRSS4 antikoerper, tmprss4a antikoerper, Tmprss4 antikoerper
- Hintergrund
- This gene encodes a member of the serine protease family. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified as a gene overexpressed in pancreatic carcinoma. The encoded protein is membrane bound with a N-terminal anchor sequence and a glycosylated extracellular region containing the serine protease domain. Multiple transcript variants encoding different isoforms have been found for this gene.
- Molekulargewicht
- 48 kDa (MW of target protein)
-