PLEKHO1 Antikörper (N-Term)
-
- Target Alle PLEKHO1 Antikörper anzeigen
- PLEKHO1 (Pleckstrin Homology Domain Containing, Family O Member 1 (PLEKHO1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PLEKHO1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PLEKHO1 antibody was raised against the N terminal of PLEKHO1
- Aufreinigung
- Affinity purified
- Immunogen
- PLEKHO1 antibody was raised using the N terminal of PLEKHO1 corresponding to a region with amino acids MMKKNNSAKRGPQDGNQQPAPPEKVGWVRKFCGKGIFREIWKNRYVVLKG
- Top Product
- Discover our top product PLEKHO1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PLEKHO1 Blocking Peptide, catalog no. 33R-6233, is also available for use as a blocking control in assays to test for specificity of this PLEKHO1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLEKHO1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PLEKHO1 (Pleckstrin Homology Domain Containing, Family O Member 1 (PLEKHO1))
- Andere Bezeichnung
- PLEKHO1 (PLEKHO1 Produkte)
- Hintergrund
- PLEKHO1 plays a role in the regulation of the actin cytoskeleton through its interactions with actin capping protein (CP).PLEKHO1 may function to target CK2 to the plasma membrane thereby serving as an adapter to facilitate the phosphorylation of CP by protein kinase 2 (CK2). PLEKHO1 appears to target ATM to the plasma membrane. PLEKHO1 appears to also inhibit tumor cell growth by inhibiting AKT-mediated cell-survival. PLEKHO1 is also implicated in PI3K-regulated muscle differentiation, the regulation of AP-1 activity (plasma membrane bound AP-1 regulator that translocates to the nucleus) and the promotion of apoptosis induced by tumor necrosis factor TNF. When bound to PKB, it inhibits it probably by decreasing PKB level of phosphorylation.
- Molekulargewicht
- 46 kDa (MW of target protein)
-