NXPH3 Antikörper (Middle Region)

Produktnummer ABIN633044

Der Kaninchen Polyklonal Anti-NXPH3-Antikörper wurde für WB validiert. Er ist geeignet, NXPH3 in Proben von Human zu detektieren.

Kurzübersicht für NXPH3 Antikörper (Middle Region) (ABIN633044)

Target: NXPH3 (Neurexophilin 3 (NXPH3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NXPH3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NXPH3 Antikörper

Bindungsspezifität: Middle Region

Spezifität: Neurexophilin 3 antibody was raised against the middle region of NXPH3

Aufreinigung: Affinity purified

Immunogen: Neurexophilin 3 antibody was raised using the middle region of NXPH3 corresponding to a region with amino acids NISISLVPPSKAVEFHQEQQIFIEAKASKIFNCRMEWEKVERGRRTSLCT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Neurexophilin 3 Blocking Peptide, (ABIN5614965), is also available for use as a blocking control in assays to test for specificity of this Neurexophilin 3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NXPH3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NXPH3

Target: NXPH3 (Neurexophilin 3 (NXPH3))

Andere Bezeichnung: Neurexophilin 3

Hintergrund: NXPH3 may be signaling molecules that resemble neuropeptides. Ligand for alpha-neurexins.

Molekulargewicht: 28 kDa (MW of target protein)