-
- Target Alle KLHL2 Antikörper anzeigen
- KLHL2 (Kelch-Like 2, Mayven (KLHL2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KLHL2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- KLHL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYAEQHFADVVLSEEFLNLGIEQVCSLISSDKLTISSEEKVFEAVIAWVN
- Top Product
- Discover our top product KLHL2 Primärantikörper
-
anti-Kelch-Like 2, Mayven (KLHL2) (AA 1-100), (AA 494-593) antibody
KLHL2 Reaktivität: Human, Hund, Affe WB, IF, FACS Wirt: Maus Monoclonal 1G7 unconjugated
anti-Kelch-Like 2, Mayven (KLHL2) (AA 1-200) antibodyKLHL2 Reaktivität: Human ELISA, IF, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Kelch-Like 2, Mayven (KLHL2) (AA 1-155) antibodyKLHL2 Reaktivität: Human WB, ELISA, IF, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Kelch-Like 2, Mayven (KLHL2) (AA 1-100), (AA 494-593) antibodyKLHL2 Reaktivität: Human WB, IF, FACS Wirt: Maus Monoclonal 8B8 unconjugated
anti-Kelch-Like 2, Mayven (KLHL2) (AA 1-100), (AA 494-593) antibodyKLHL2 Reaktivität: Human WB, IF, FACS Wirt: Maus Monoclonal 3H9 unconjugated
anti-Kelch-Like 2, Mayven (KLHL2) (AA 1-66) antibodyKLHL2 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 3G3 unconjugated
anti-Kelch-Like 2, Mayven (KLHL2) (AA 77-103), (N-Term) antibodyKLHL2 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB37594 unconjugated
anti-Kelch-Like 2, Mayven (KLHL2) (AA 1-593) antibodyKLHL2 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Kelch-Like 2, Mayven (KLHL2) (AA 179-228) antibodyKLHL2 Reaktivität: Human, Maus, Ratte, Hund, Rind (Kuh), Meerschweinchen, Pferd, Affe, Kaninchen, Fledermaus, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
anti-Kelch-Like 2, Mayven (KLHL2) (Middle Region) antibodyKLHL2 Reaktivität: Human, Maus, Ratte, Hund, Rind (Kuh), Meerschweinchen, Pferd, Kaninchen, Zebrafisch (Danio rerio) WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KLHL2 Blocking Peptide, catalog no. 33R-9385, is also available for use as a blocking control in assays to test for specificity of this KLHL2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KLHL2 (Kelch-Like 2, Mayven (KLHL2))
- Andere Bezeichnung
- KLHL2 (KLHL2 Produkte)
- Hintergrund
- KLHL2 may play a role in organizing the actin cytoskeleton of the brain cells.
- Molekulargewicht
- 66 kDa (MW of target protein)
-
Sie sind hier:
