KLHL2 Antikörper

Produktnummer ABIN633041

Der Kaninchen Polyklonal Anti-KLHL2-Antikörper wurde für WB validiert. Er ist geeignet, KLHL2 in Proben von Human zu detektieren.

Kurzübersicht für KLHL2 Antikörper (ABIN633041)

Target: KLHL2 (Kelch-Like 2, Mayven (KLHL2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KLHL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KLHL2 Antikörper

Aufreinigung: Affinity purified

Immunogen: KLHL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYAEQHFADVVLSEEFLNLGIEQVCSLISSDKLTISSEEKVFEAVIAWVN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KLHL2 Blocking Peptide, (ABIN5614378), is also available for use as a blocking control in assays to test for specificity of this KLHL2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KLHL2

Target: KLHL2 (Kelch-Like 2, Mayven (KLHL2))

Andere Bezeichnung: KLHL2

Hintergrund: KLHL2 may play a role in organizing the actin cytoskeleton of the brain cells.

Molekulargewicht: 66 kDa (MW of target protein)