ATPAF1 Antikörper (N-Term)

Produktnummer ABIN633038

Der Kaninchen Polyklonal Anti-ATPAF1-Antikörper wurde für WB validiert. Er ist geeignet, ATPAF1 in Proben von Human zu detektieren.

Kurzübersicht für ATPAF1 Antikörper (N-Term) (ABIN633038)

Target: ATPAF1 (ATP Synthase Mitochondrial F1 Complex Assembly Factor 1 (ATPAF1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATPAF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ATPAF1 Antikörper

Bindungsspezifität: N-Term

Spezifität: ATPAF1 antibody was raised against the N terminal of ATPAF1

Aufreinigung: Affinity purified

Immunogen: ATPAF1 antibody was raised using the N terminal of ATPAF1 corresponding to a region with amino acids GLGLVSPAQLRVFPVRPGSGRPEGGADSSGVGAEAELQANPFYDRYRDKI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ATPAF1 Blocking Peptide, (ABIN938779), is also available for use as a blocking control in assays to test for specificity of this ATPAF1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATPAF1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATPAF1

Target: ATPAF1 (ATP Synthase Mitochondrial F1 Complex Assembly Factor 1 (ATPAF1))

Andere Bezeichnung: ATPAF1

Hintergrund: This gene encodes an assembly factor for the F(1) component of the mitochondrial ATP synthase. This protein binds specifically to the F1 beta subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. Alternatively spliced transcript variants have been identified, but the biological validity of some of these variants has not been determined.

Molekulargewicht: 29 kDa (MW of target protein)