TINAG Antikörper (Middle Region)

Produktnummer ABIN633037

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch TINAG in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für TINAG Antikörper (Middle Region) (ABIN633037)

Target: TINAG (Tubulointerstitial Nephritis Antigen (TINAG))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TINAG Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TINAG Antikörper

Bindungsspezifität: Middle Region

Spezifität: TINAG antibody was raised against the middle region of TINAG

Aufreinigung: Affinity purified

Immunogen: TINAG antibody was raised using the middle region of TINAG corresponding to a region with amino acids VAADRIAIQSKGRYTANLSPQNLISCCAKNRHGCNSGSIDRAWWYLRKRG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TINAG Blocking Peptide, (ABIN5616610), is also available for use as a blocking control in assays to test for specificity of this TINAG antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TINAG antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TINAG

Target: TINAG (Tubulointerstitial Nephritis Antigen (TINAG))

Andere Bezeichnung: TINAG

Hintergrund: TINAG is a basement membrane glycoprotein initially identified as a target of antibodies in some forms of immunologically mediated tubulointerstitial nephritis.

Molekulargewicht: 54 kDa (MW of target protein)