C21orf58 Antikörper (N-Term)

Produktnummer ABIN633031

Produktdetails anti-C21orf58 Antikörper

Target: C21orf58 (Chromosome 21 Open Reading Frame 58 (C21orf58))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C21orf58 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C21 orf58 antibody was raised against the N terminal of C21 rf58

Aufreinigung: Affinity purified

Immunogen: C21 orf58 antibody was raised using the N terminal of C21 rf58 corresponding to a region with amino acids MARSRLPATSLRKPWKLDRQKLPSPDSGHSLLCGWSPGGKARPAGNTGAW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C21orf58 Blocking Peptide, catalog no. 33R-5735, is also available for use as a blocking control in assays to test for specificity of this C21orf58 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 rf58 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C21orf58

Target: C21orf58 (Chromosome 21 Open Reading Frame 58 (C21orf58))

Andere Bezeichnung: C21orf58 (C21orf58 Produkte)

Synonyme: chromosome 21 open reading frame 58 antikoerper, chromosome 7 C21orf58 homolog antikoerper, C21orf58 antikoerper, C7H21orf58 antikoerper

Hintergrund: The function of Chromosome 21 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 35 kDa (MW of target protein)