LRRC3 Antikörper (Middle Region)

Produktnummer ABIN633029

Der Kaninchen Polyklonal Anti-LRRC3-Antikörper wurde für WB validiert. Er ist geeignet, LRRC3 in Proben von Human zu detektieren.

Kurzübersicht für LRRC3 Antikörper (Middle Region) (ABIN633029)

Target: LRRC3 (Leucine Rich Repeat Containing 3 (LRRC3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LRRC3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LRRC3 Antikörper

Bindungsspezifität: Middle Region

Spezifität: LRRC3 antibody was raised against the middle region of LRRC3

Aufreinigung: Affinity purified

Immunogen: LRRC3 antibody was raised using the middle region of LRRC3 corresponding to a region with amino acids TFAGLAGGLRLLDLSYNRIQRIPKDALGKLSAKIRLSHNPLHCECALQEA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LRRC3 Blocking Peptide, (ABIN5614573), is also available for use as a blocking control in assays to test for specificity of this LRRC3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LRRC3

Target: LRRC3 (Leucine Rich Repeat Containing 3 (LRRC3))

Andere Bezeichnung: LRRC3

Hintergrund: The function of LRRC3 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 25 kDa (MW of target protein)