S100PBP Antikörper (Middle Region)

Produktnummer ABIN633020

Produktdetails anti-S100PBP Antikörper

Target: S100PBP (S100P Binding Protein (S100PBP))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser S100PBP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: S100 PBP antibody was raised against the middle region of S100 BP

Aufreinigung: Affinity purified

Immunogen: S100 PBP antibody was raised using the middle region of S100 BP corresponding to a region with amino acids ERRLGKVIPVLQTKTRTNVPTFSQSNLEQQKQLYLRSVIAHIEDPEDTNQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

S100PBP Blocking Peptide, catalog no. 33R-2713, is also available for use as a blocking control in assays to test for specificity of this S100PBP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of S100 BP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu S100PBP

Target: S100PBP (S100P Binding Protein (S100PBP))

Andere Bezeichnung: S100PBP (S100PBP Produkte)

Synonyme: s100pbpr antikoerper, S100PBPR antikoerper, 4930429A08Rik antikoerper, AI851343 antikoerper, S100pbpr antikoerper, RGD1564943 antikoerper, S100P binding protein antikoerper, S100P binding protein L homeolog antikoerper, S100PBP antikoerper, s100pbp antikoerper, S100pbp antikoerper, s100pbp.L antikoerper

Hintergrund: The function of S100PBP protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 37 kDa (MW of target protein)