SDR16C5 Antikörper (Middle Region)

Produktnummer ABIN633013

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch SDR16C5 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für SDR16C5 Antikörper (Middle Region) (ABIN633013)

Target: SDR16C5 (RDHE2) (Epidermal Retinal Dehydrogenase 2 (RDHE2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SDR16C5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SDR16C5 Antikörper

Bindungsspezifität: Middle Region

Spezifität: RDHE2 antibody was raised against the middle region of RDHE2

Aufreinigung: Affinity purified

Immunogen: RDHE2 antibody was raised using the middle region of RDHE2 corresponding to a region with amino acids AGLSGVNGLADYCASKFAAFGFAESVFVETFVQKQKGIKTTIVCPFFIKT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RDHE2 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this RDHE2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDHE2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SDR16C5

Target: SDR16C5 (RDHE2) (Epidermal Retinal Dehydrogenase 2 (RDHE2))

Andere Bezeichnung: RDHE2

Hintergrund: The specific function of RDHE2 is not yet known.

Molekulargewicht: 34 kDa (MW of target protein)