IQCD Antikörper (N-Term)

Produktnummer ABIN633012

Produktdetails anti-IQCD Antikörper

Target: IQCD (IQ Motif Containing D (IQCD))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IQCD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: IQCD antibody was raised against the N terminal of IQCD

Aufreinigung: Affinity purified

Immunogen: IQCD antibody was raised using the N terminal of IQCD corresponding to a region with amino acids ALDILAMAPLYQAPAINRIGPKTDPSKRPADPLKPLVLSRTKLTTIEAKR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IQCD Blocking Peptide, catalog no. 33R-1322, is also available for use as a blocking control in assays to test for specificity of this IQCD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IQCD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IQCD

Target: IQCD (IQ Motif Containing D (IQCD))

Andere Bezeichnung: IQCD (IQCD Produkte)

Synonyme: 4933433C09Rik antikoerper, AI662646 antikoerper, IQ motif containing D antikoerper, IQCD antikoerper, Iqcd antikoerper

Hintergrund: IQCD contains 1 IQ domain. The function of the IQCD protein is not known.

Molekulargewicht: 40 kDa (MW of target protein)