SFRS12 Antikörper (N-Term)
-
- Target Alle SFRS12 (SREK1) Antikörper anzeigen
- SFRS12 (SREK1) (Splicing Regulatory Glutamine/lysine-Rich Protein 1 (SREK1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SFRS12 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SFRS12 antibody was raised against the N terminal of SFRS12
- Aufreinigung
- Affinity purified
- Immunogen
- SFRS12 antibody was raised using the N terminal of SFRS12 corresponding to a region with amino acids DPSSVGVAQHLTNTVFIDRALIVVPCAEGKIPEESKALSLLAPAPTMTSL
- Top Product
- Discover our top product SREK1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SFRS12 Blocking Peptide, catalog no. 33R-2117, is also available for use as a blocking control in assays to test for specificity of this SFRS12 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS12 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SFRS12 (SREK1) (Splicing Regulatory Glutamine/lysine-Rich Protein 1 (SREK1))
- Andere Bezeichnung
- SFRS12 (SREK1 Produkte)
- Synonyme
- SFRS12 antikoerper, SRrp508 antikoerper, SRrp86 antikoerper, Sfrs12 antikoerper, Srrp86 antikoerper, Srsf12 antikoerper, 8430401B01 antikoerper, AI450757 antikoerper, AI462342 antikoerper, zgc:100974 antikoerper, splicing regulatory glutamic acid and lysine rich protein 1 antikoerper, splicing regulatory glutamine/lysine-rich protein 1 antikoerper, SREK1 antikoerper, Srek1 antikoerper, srek1 antikoerper
- Hintergrund
- SFRS12 belongs to the superfamily of serine/arginine-rich (SR) splicing factors. It modulates splice site selection by regulating the activities of other SR proteins.
- Molekulargewicht
- 72 kDa (MW of target protein)
-