PARP11 Antikörper

Produktnummer ABIN633008

Der Kaninchen-Polyklonal Anti-PARP11-Antikörper wurde für WB validiert. Er ist geeignet zum Nachweis von PARP11 in Proben aus Human. }

Kurzübersicht für PARP11 Antikörper (ABIN633008)

Target: PARP11 (Poly (ADP-Ribose) Polymerase Family, Member 11 (PARP11))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PARP11 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PARP11 Antikörper

Aufreinigung: Affinity purified

Immunogen: PARP11 antibody was raised using a synthetic peptide corresponding to a region with amino acids SAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP11 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PARP11

Target: PARP11 (Poly (ADP-Ribose) Polymerase Family, Member 11 (PARP11))

Andere Bezeichnung: PARP11

Hintergrund: The PARP11 gene is part of the poly (ADP-ribose) polymerase family.

Molekulargewicht: 39 kDa (MW of target protein)