PARP11 Antikörper
-
- Target Alle PARP11 Produkte
- PARP11 (Poly (ADP-Ribose) Polymerase Family, Member 11 (PARP11))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PARP11 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PARP11 antibody was raised using a synthetic peptide corresponding to a region with amino acids SAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTM
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP11 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PARP11 (Poly (ADP-Ribose) Polymerase Family, Member 11 (PARP11))
- Andere Bezeichnung
- PARP11 (PARP11 Produkte)
- Hintergrund
- The PARP11 gene is part of the poly (ADP-ribose) polymerase family.
- Molekulargewicht
- 39 kDa (MW of target protein)
-