HSPA1L Antikörper (C-Term)

Produktnummer ABIN633004

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch HSPA1L in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für HSPA1L Antikörper (C-Term) (ABIN633004)

Target: HSPA1L (Heat Shock 70kDa Protein 1-Like (HSPA1L))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HSPA1L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HSPA1L Antikörper

Bindungsspezifität: C-Term

Spezifität: HSPA1 L antibody was raised against the C terminal of HSPA1

Aufreinigung: Affinity purified

Immunogen: HSPA1 L antibody was raised using the C terminal of HSPA1 corresponding to a region with amino acids DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HSPA1L Blocking Peptide, (ABIN937286), is also available for use as a blocking control in assays to test for specificity of this HSPA1L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HSPA1L

Target: HSPA1L (Heat Shock 70kDa Protein 1-Like (HSPA1L))

Andere Bezeichnung: HSPA1L

Hintergrund: HSPA1L is a 70 kDa heat shock protein. In conjunction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles.

Molekulargewicht: 70 kDa (MW of target protein)