HSPA1L Antikörper (C-Term)

Produktnummer ABIN633004

Produktdetails anti-HSPA1L Antikörper

Target: HSPA1L (Heat Shock 70kDa Protein 1-Like (HSPA1L))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HSPA1L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HSPA1 L antibody was raised against the C terminal of HSPA1

Aufreinigung: Affinity purified

Immunogen: HSPA1 L antibody was raised using the C terminal of HSPA1 corresponding to a region with amino acids DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HSPA1L Blocking Peptide, catalog no. 33R-1900, is also available for use as a blocking control in assays to test for specificity of this HSPA1L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HSPA1L

Target: HSPA1L (Heat Shock 70kDa Protein 1-Like (HSPA1L))

Andere Bezeichnung: HSPA1L (HSPA1L Produkte)

Synonyme: Hsc70t antikoerper, Msh5 antikoerper, HSPA1L antikoerper, hspa1l antikoerper, MGC147483 antikoerper, Hsp70-3 antikoerper, HSP70-1L antikoerper, HSP70-HOM antikoerper, HSP70T antikoerper, hum70t antikoerper, heat shock 70kDa protein 1-like antikoerper, heat shock protein 1-like antikoerper, heat shock 70 kDa protein 1-like antikoerper, heat shock protein family A (Hsp70) member 1 like antikoerper, HSPA1L antikoerper, Hspa1l antikoerper, LOC471967 antikoerper, hspa1l antikoerper, LOC474850 antikoerper, LOC102177850 antikoerper, LOC100050904 antikoerper

Hintergrund: HSPA1L is a 70 kDa heat shock protein. In conjunction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles.

Molekulargewicht: 70 kDa (MW of target protein)