PEF1 Antikörper (Middle Region)

Produktnummer ABIN633001

Produktdetails anti-PEF1 Antikörper

Target: PEF1 (Penta-EF-Hand Domain Containing 1 (PEF1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PEF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PEF1 antibody was raised against the middle region of PEF1

Aufreinigung: Affinity purified

Immunogen: PEF1 antibody was raised using the middle region of PEF1 corresponding to a region with amino acids WKFIQQWKNLFQQYDRDRSGSISYTELQQALSQMGYNLSPQFTQLLVSRY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PEF1 Blocking Peptide, catalog no. 33R-9960, is also available for use as a blocking control in assays to test for specificity of this PEF1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEF1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PEF1

Target: PEF1 (Penta-EF-Hand Domain Containing 1 (PEF1))

Andere Bezeichnung: PEF1 (PEF1 Produkte)

Synonyme: 2600002E23Rik antikoerper, Peflin antikoerper, ABP32 antikoerper, PEF1A antikoerper, zgc:100787 antikoerper, penta-EF hand domain containing 1 antikoerper, penta-EF-hand domain containing 1 antikoerper, penta-EF-hand domain containing 1 L homeolog antikoerper, Pef1 antikoerper, PEF1 antikoerper, pef1 antikoerper, pef1.L antikoerper

Hintergrund: PEF1 is a Ca(2+)-binding protein that belongs to the penta-EF-hand (PEF) protein family, which includes the calpain small subunit, sorcin, grancalcin, and ALG2.PEF1 is a Ca(2+)-binding protein that belongs to the penta-EF-hand (PEF) protein family, which includes the calpain small subunit.

Molekulargewicht: 31 kDa (MW of target protein)