LYSMD2 Antikörper (Middle Region)

Produktnummer ABIN632998

Produktdetails anti-LYSMD2 Antikörper

Target: LYSMD2 (LysM, Putative Peptidoglycan-Binding, Domain Containing 2 (LYSMD2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LYSMD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LYSMD2 antibody was raised against the middle region of LYSMD2

Aufreinigung: Affinity purified

Immunogen: LYSMD2 antibody was raised using the middle region of LYSMD2 corresponding to a region with amino acids VEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLNIPVISE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LYSMD2 Blocking Peptide, catalog no. 33R-9496, is also available for use as a blocking control in assays to test for specificity of this LYSMD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYSMD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LYSMD2

Target: LYSMD2 (LysM, Putative Peptidoglycan-Binding, Domain Containing 2 (LYSMD2))

Andere Bezeichnung: LYSMD2 (LYSMD2 Produkte)

Synonyme: 2210402C18Rik antikoerper, AV033872 antikoerper, AW538442 antikoerper, RGD1304585 antikoerper, zgc:91941 antikoerper, MGC108236 antikoerper, LysM, putative peptidoglycan-binding, domain containing 2 antikoerper, LysM domain containing 2 antikoerper, LysM, putative peptidoglycan-binding, domain containing 2 L homeolog antikoerper, Lysmd2 antikoerper, LYSMD2 antikoerper, lysmd2.L antikoerper, lysmd2 antikoerper

Hintergrund: The function of LYSMD2 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 23 kDa (MW of target protein)