LYSMD2 Antikörper (Middle Region)

Produktnummer ABIN632998

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch LYSMD2 in WB. Er zeigt eine Reaktivität gegenüber Human und Maus.

Kurzübersicht für LYSMD2 Antikörper (Middle Region) (ABIN632998)

Target: LYSMD2 (LysM, Putative Peptidoglycan-Binding, Domain Containing 2 (LYSMD2))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LYSMD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LYSMD2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: LYSMD2 antibody was raised against the middle region of LYSMD2

Aufreinigung: Affinity purified

Immunogen: LYSMD2 antibody was raised using the middle region of LYSMD2 corresponding to a region with amino acids VEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLNIPVISE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LYSMD2 Blocking Peptide, (ABIN5614617), is also available for use as a blocking control in assays to test for specificity of this LYSMD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYSMD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LYSMD2

Target: LYSMD2 (LysM, Putative Peptidoglycan-Binding, Domain Containing 2 (LYSMD2))

Andere Bezeichnung: LYSMD2

Hintergrund: The function of LYSMD2 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 23 kDa (MW of target protein)