Arc Antikörper (Middle Region)

Produktnummer ABIN632995

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch Arc in WB. Es zeigt Reaktivität gegenüber Proben von Human, Ratte und Maus.

Kurzübersicht für Arc Antikörper (Middle Region) (ABIN632995)

Target: Arc (Activity-Regulated Cytoskeleton-Associated Protein (Arc))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Arc Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Arc Antikörper

Bindungsspezifität: Middle Region

Spezifität: ARC antibody was raised against the middle region of ARC

Aufreinigung: Affinity purified

Immunogen: ARC antibody was raised using the middle region of ARC corresponding to a region with amino acids ELDLPQKQGEPLDQFLWRKRDLYQTLYVDADEEEIIQYVVGTLQPKLKRF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ARC Blocking Peptide, (ABIN937920), is also available for use as a blocking control in assays to test for specificity of this ARC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Arc

Target: Arc (Activity-Regulated Cytoskeleton-Associated Protein (Arc))

Andere Bezeichnung: ARC

Hintergrund: ARC is required for consolidation of synaptic plasticity as well as formation of long-term memory. It regulates endocytosis of AMPA receptors in response to synaptic activity. The protein is also required for homeostatic synaptic scaling of AMPA receptors.

Molekulargewicht: 45 kDa (MW of target protein)