LACTB2 Antikörper (Middle Region)
-
- Target Alle LACTB2 Antikörper anzeigen
- LACTB2 (Lactamase, beta 2 (LACTB2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LACTB2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Beta Lactamase 2 antibody was raised against the middle region of LACTB2
- Aufreinigung
- Affinity purified
- Immunogen
- Beta Lactamase 2 antibody was raised using the middle region of LACTB2 corresponding to a region with amino acids NPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEE
- Top Product
- Discover our top product LACTB2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Beta Lactamase 2 Blocking Peptide, catalog no. 33R-6830, is also available for use as a blocking control in assays to test for specificity of this Beta Lactamase 2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LACTB2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LACTB2 (Lactamase, beta 2 (LACTB2))
- Abstract
- LACTB2 Produkte
- Synonyme
- Cgi-83 antikoerper, E430032H21Rik antikoerper, lactb2 antikoerper, lactamase beta 2 antikoerper, lactamase beta 2 L homeolog antikoerper, lactamase, beta 2 antikoerper, LACTB2 antikoerper, lactb2.L antikoerper, Lactb2 antikoerper, lactb2 antikoerper
- Hintergrund
- The specific function of LACTB2 is not yet known.
- Molekulargewicht
- 33 kDa (MW of target protein)
-