LACTB2 Antikörper (Middle Region)

Produktnummer ABIN632991

Dieses Anti-LACTB2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von LACTB2 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für LACTB2 Antikörper (Middle Region) (ABIN632991)

Target: LACTB2 (Lactamase, beta 2 (LACTB2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LACTB2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LACTB2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: Beta Lactamase 2 antibody was raised against the middle region of LACTB2

Aufreinigung: Affinity purified

Immunogen: Beta Lactamase 2 antibody was raised using the middle region of LACTB2 corresponding to a region with amino acids NPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Beta Lactamase 2 Blocking Peptide, (ABIN5612322), is also available for use as a blocking control in assays to test for specificity of this Beta Lactamase 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LACTB2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LACTB2

Target: LACTB2 (Lactamase, beta 2 (LACTB2))

Hintergrund: The specific function of LACTB2 is not yet known.

Molekulargewicht: 33 kDa (MW of target protein)