C9orf43 Antikörper (Middle Region)

Produktnummer ABIN632984

Produktdetails anti-C9orf43 Antikörper

Target: C9orf43 (Chromosome 9 Open Reading Frame 43 (C9orf43))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C9orf43 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C9 ORF43 antibody was raised against the middle region of C9 rf43

Aufreinigung: Affinity purified

Immunogen: C9 ORF43 antibody was raised using the middle region of C9 rf43 corresponding to a region with amino acids PEAQAARQKKISFNFSEIMASTGWNSELKLLRILQDTDDEDEEDQSSGAE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C9ORF43 Blocking Peptide, catalog no. 33R-7032, is also available for use as a blocking control in assays to test for specificity of this C9ORF43 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF43 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C9orf43

Target: C9orf43 (Chromosome 9 Open Reading Frame 43 (C9orf43))

Andere Bezeichnung: C9ORF43 (C9orf43 Produkte)

Synonyme: C9orf43 antikoerper, chromosome 9 open reading frame 43 antikoerper, chromosome 15 open reading frame, human C9orf43 antikoerper, C9orf43 antikoerper, C15H9orf43 antikoerper

Hintergrund: The function of the C9orf43 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 52 kDa (MW of target protein)