Cytohesin 4 Antikörper (N-Term)

Produktnummer ABIN632981

Der Kaninchen Polyklonal anti-Cytohesin 4 Antikörper wird verwendet zum Nachweis von Cytohesin 4 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für Cytohesin 4 Antikörper (N-Term) (ABIN632981)

Target: Cytohesin 4 (CYTH4)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Cytohesin 4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Cytohesin 4 Antikörper

Bindungsspezifität: N-Term

Spezifität: PSCD4 antibody was raised against the N terminal of PSCD4

Aufreinigung: Affinity purified

Immunogen: PSCD4 antibody was raised using the N terminal of PSCD4 corresponding to a region with amino acids NKTAIGTYLGERDPINLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PSCD4 Blocking Peptide, (ABIN5615608), is also available for use as a blocking control in assays to test for specificity of this PSCD4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSCD4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Cytohesin 4

Target: Cytohesin 4 (CYTH4)

Andere Bezeichnung: PSCD4

Hintergrund: PSCD4 promotes guanine-nucleotide exchange on ARF1 and ARF5. PSCD4 promotes the activation of ARF through replacement of GDP with GTP.Pleckstrin homology, Sec7 and coiled/coil domains 4 (PSCD4) is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain.

Molekulargewicht: 46 kDa (MW of target protein)