USP18 Antikörper (N-Term)

Produktnummer ABIN632980

Produktdetails anti-USP18 Antikörper

Target: USP18 (Ubiquitin Specific Peptidase 18 (USP18))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser USP18 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: USP18 antibody was raised against the N terminal of USP18

Aufreinigung: Affinity purified

Immunogen: USP18 antibody was raised using the N terminal of USP18 corresponding to a region with amino acids MQDSRQKAVRPLELAYCLQKCNVPLFVQHDAAQLYLKLWNLIKDQITDVH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

USP18 Blocking Peptide, catalog no. 33R-6322, is also available for use as a blocking control in assays to test for specificity of this USP18 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of USP18 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu USP18

Target: USP18 (Ubiquitin Specific Peptidase 18 (USP18))

Andere Bezeichnung: USP18 (USP18 Produkte)

Synonyme: ISG43 antikoerper, UBP43 antikoerper, bubp43 antikoerper, 1110058H21Rik antikoerper, AW047653 antikoerper, Ubp15 antikoerper, UBP antikoerper, USP18 antikoerper, USP41 antikoerper, ubiquitin specific peptidase 18 antikoerper, USP18 antikoerper, Usp18 antikoerper

Hintergrund: USP18, a member of the deubiquitinating protease family of enzymes, removes ubiquitin adducts from a broad range of protein substrates.

Molekulargewicht: 43 kDa (MW of target protein)