FAM36A Antikörper (Middle Region)

Produktnummer ABIN632967

Dieser Anti-FAM36A-Antikörper ist ein Kaninchen-Polyklonal-Antikörper zum Nachweis von FAM36A in WB. Geeignet für Human.

Kurzübersicht für FAM36A Antikörper (Middle Region) (ABIN632967)

Target: FAM36A (Family with Sequence Similarity 36, Member A (FAM36A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM36A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FAM36A Antikörper

Bindungsspezifität: Middle Region

Spezifität: FAM36 A antibody was raised against the middle region of FAM36

Aufreinigung: Affinity purified

Immunogen: FAM36 A antibody was raised using the middle region of FAM36 corresponding to a region with amino acids LGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM36A Blocking Peptide, (ABIN940353), is also available for use as a blocking control in assays to test for specificity of this FAM36A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM30 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM36A

Target: FAM36A (Family with Sequence Similarity 36, Member A (FAM36A))

Andere Bezeichnung: FAM36A

Hintergrund: FAM36A is a multi-pass membrane protein. It belongs to the FAM36 family. The exact function of FAM36A remains unknown.

Molekulargewicht: 13 kDa (MW of target protein)