GLRX3 Antikörper (N-Term)

Produktnummer ABIN632963

Produktdetails anti-GLRX3 Antikörper

Target: GLRX3 (Glutaredoxin 3 (GLRX3))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GLRX3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GLRX3 antibody was raised against the N terminal of GLRX3

Aufreinigung: Affinity purified

Immunogen: GLRX3 antibody was raised using the N terminal of GLRX3 corresponding to a region with amino acids MEELLRRELGCSSVRATGHSGGGCISQGRSYDTDQGRVFVKVNPKAEARR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GLRX3 Blocking Peptide, catalog no. 33R-5905, is also available for use as a blocking control in assays to test for specificity of this GLRX3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLRX3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GLRX3

Target: GLRX3 (Glutaredoxin 3 (GLRX3))

Andere Bezeichnung: GLRX3 (GLRX3 Produkte)

Synonyme: GLRX4 antikoerper, GRX3 antikoerper, GRX4 antikoerper, PICOT antikoerper, TXNL2 antikoerper, TXNL3 antikoerper, Txnl2 antikoerper, txnl2 antikoerper, wu:fb38e09 antikoerper, zgc:103648 antikoerper, NME/NM23 family member 9 antikoerper, thioredoxin-like 2 antikoerper, glutaredoxin 3 antikoerper, NME9 antikoerper, LOC100285323 antikoerper, GLRX3 antikoerper, Glrx3 antikoerper, glrx3 antikoerper

Hintergrund: GLRX3 may play a role in regulating the function of the thioredoxin system.

Molekulargewicht: 37 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis