GLRX3 Antikörper (N-Term)

Produktnummer ABIN632963

Der Kaninchen Polyklonal Anti-GLRX3-Antikörper wurde für WB validiert. Er ist geeignet, GLRX3 in Proben von Human zu detektieren.

Kurzübersicht für GLRX3 Antikörper (N-Term) (ABIN632963)

Target: GLRX3 (Glutaredoxin 3 (GLRX3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GLRX3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GLRX3 Antikörper

Bindungsspezifität: N-Term

Spezifität: GLRX3 antibody was raised against the N terminal of GLRX3

Aufreinigung: Affinity purified

Immunogen: GLRX3 antibody was raised using the N terminal of GLRX3 corresponding to a region with amino acids MEELLRRELGCSSVRATGHSGGGCISQGRSYDTDQGRVFVKVNPKAEARR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GLRX3 Blocking Peptide, (ABIN5613786), is also available for use as a blocking control in assays to test for specificity of this GLRX3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLRX3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GLRX3

Target: GLRX3 (Glutaredoxin 3 (GLRX3))

Andere Bezeichnung: GLRX3

Hintergrund: GLRX3 may play a role in regulating the function of the thioredoxin system.

Molekulargewicht: 37 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis