SNAP47 Antikörper (Middle Region)

Produktnummer ABIN632958

Der Kaninchen Polyklonal anti-SNAP47 Antikörper (ABIN632958) detektiert spezifisch SNAP47 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für SNAP47 Antikörper (Middle Region) (ABIN632958)

Target: SNAP47 (Synaptosomal-Associated Protein, 47kDa (SNAP47))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SNAP47 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SNAP47 Antikörper

Bindungsspezifität: Middle Region

Spezifität: C1 ORF142 antibody was raised against the middle region of C1 rf142

Aufreinigung: Affinity purified

Immunogen: C1 ORF142 antibody was raised using the middle region of C1 rf142 corresponding to a region with amino acids TALHLQTSLPALSEADTQELTQILRRMKGLALEAESELERQDEALDGVAA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C1ORF142 Blocking Peptide, (ABIN5612454), is also available for use as a blocking control in assays to test for specificity of this C1ORF142 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF142 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SNAP47

Target: SNAP47 (Synaptosomal-Associated Protein, 47kDa (SNAP47))

Andere Bezeichnung: C1ORF142

Hintergrund: The C1ORF142 protein may play a role in intracellular membrane fusion.

Molekulargewicht: 51 kDa (MW of target protein)