BTF3P13 Antikörper (Middle Region)

Produktnummer ABIN632957

Der Kaninchen Polyklonal Anti-BTF3P13-Antikörper wurde für WB validiert. Er ist geeignet, BTF3P13 in Proben von Human zu detektieren.

Kurzübersicht für BTF3P13 Antikörper (Middle Region) (ABIN632957)

Target: BTF3P13 (Basic Transcription Factor 3 Pseudogene 13 (BTF3P13))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BTF3P13 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-BTF3P13 Antikörper

Bindungsspezifität: Middle Region

Spezifität: BTF3 L3 antibody was raised against the middle region of BTF3 3

Aufreinigung: Affinity purified

Immunogen: BTF3 L3 antibody was raised using the middle region of BTF3 3 corresponding to a region with amino acids CRSTDHEPGKLAKLQAQVRIGGKGTAHRKKKVFHRTATADDKKLQFSLKK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BTF3L3 Blocking Peptide, (ABIN937186), is also available for use as a blocking control in assays to test for specificity of this BTF3L3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BTF0 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BTF3P13

Target: BTF3P13 (Basic Transcription Factor 3 Pseudogene 13 (BTF3P13))

Andere Bezeichnung: BTF3L3

Hintergrund: BTF3L3 is a putative member of the BTF3 family of transcription factors and is thought to represent a pseudogene.

Molekulargewicht: 23 kDa (MW of target protein)