RAB22A Antikörper (Middle Region)

Produktnummer ABIN632952

Der Kaninchen Polyklonal anti-RAB22A Antikörper (ABIN632952) detektiert spezifisch RAB22A in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für RAB22A Antikörper (Middle Region) (ABIN632952)

Target: RAB22A (RAB22A, Member RAS Oncogene Family (RAB22A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAB22A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RAB22A Antikörper

Bindungsspezifität: Middle Region

Spezifität: RAB22 A antibody was raised against the middle region of RAB22

Aufreinigung: Affinity purified

Immunogen: RAB22 A antibody was raised using the middle region of RAB22 corresponding to a region with amino acids IFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAB22A Blocking Peptide, (ABIN939350), is also available for use as a blocking control in assays to test for specificity of this RAB22A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB20 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAB22A

Target: RAB22A (RAB22A, Member RAS Oncogene Family (RAB22A))

Andere Bezeichnung: RAB22A

Hintergrund: The protein encoded by this gene is a member of the RAB family of small GTPases. The GTP-bound form of the encoded protein has been shown to interact with early-endosomal antigen 1, and may be involved in the trafficking of and interaction between endosom

Molekulargewicht: 22 kDa (MW of target protein)