SASH3 Antikörper (N-Term)

Produktnummer ABIN632950

Produktdetails anti-SASH3 Antikörper

Target: SASH3 (SAM and SH3 Domain Containing 3 (SASH3))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SASH3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CXORF9 antibody was raised against the N terminal Of Cxorf9

Aufreinigung: Affinity purified

Immunogen: CXORF9 antibody was raised using the N terminal Of Cxorf9 corresponding to a region with amino acids KPSSPVVSEKEFNLDDNIPEDDSGVPTPEDAGKSGKKLGKKWRAVISRTM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CXORF9 Blocking Peptide, catalog no. 33R-4594, is also available for use as a blocking control in assays to test for specificity of this CXORF9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CXORF9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SASH3

Target: SASH3 (SAM and SH3 Domain Containing 3 (SASH3))

Andere Bezeichnung: CXORF9 (SASH3 Produkte)

Synonyme: 753P9 antikoerper, CXorf9 antikoerper, HACS2 antikoerper, SH3D6C antikoerper, SLY antikoerper, 1200013B08Rik antikoerper, AW413946 antikoerper, SLY1 antikoerper, HXCXORF9 antikoerper, SAM and SH3 domain containing 3 antikoerper, SASH3 antikoerper, Sash3 antikoerper

Hintergrund: The CXORF9 protein contains a Src homology-3 (SH3) domain and a sterile alpha motif (SAM), both of which are found in proteins involved in cell signaling. This protein may function as a signaling adapter protein in lymphocytes.

Molekulargewicht: 41 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response