ARHGAP15 Antikörper (Middle Region)

Produktnummer ABIN632948

Produktdetails anti-ARHGAP15 Antikörper

Target: ARHGAP15 (rho GTPase Activating Protein 15 (ARHGAP15))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ARHGAP15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ARHGAP15 antibody was raised against the middle region of ARHGAP15

Aufreinigung: Affinity purified

Immunogen: ARHGAP15 antibody was raised using the middle region of ARHGAP15 corresponding to a region with amino acids VKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ARHGAP15 Blocking Peptide, catalog no. 33R-9637, is also available for use as a blocking control in assays to test for specificity of this ARHGAP15 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARHGAP15 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ARHGAP15

Target: ARHGAP15 (rho GTPase Activating Protein 15 (ARHGAP15))

Andere Bezeichnung: ARHGAP15 (ARHGAP15 Produkte)

Synonyme: pp905 antikoerper, sh3d20 antikoerper, sh3p20 antikoerper, camgap1 antikoerper, BM046 antikoerper, 5830480G12Rik antikoerper, Rho GTPase activating protein 15 antikoerper, Rho GTPase activating protein 27 antikoerper, ARHGAP15 antikoerper, arhgap27 antikoerper, Arhgap15 antikoerper

Hintergrund: RHO GTPases regulate diverse biologic processes, and their activity is regulated by RHO GTPase-activating proteins (GAPs), such as ARHGAP15.

Molekulargewicht: 54 kDa (MW of target protein)