-
- Target Alle SMU1 Antikörper anzeigen
- SMU1 (Smu-1 Suppressor of Mec-8 and Unc-52 Homolog (SMU1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SMU1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SMU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KQTQPERYIHLENLLARSYFDPREAYPDGSSKEKRRAAIAQALAGEVSVV
- Top Product
- Discover our top product SMU1 Primärantikörper
-
anti-Smu-1 Suppressor of Mec-8 and Unc-52 Homolog (SMU1) (AA 1-513) antibody
SMU1 Reaktivität: Human WB, IF, ELISA Wirt: Maus Monoclonal 2B12-2F2 unconjugated
anti-Smu-1 Suppressor of Mec-8 and Unc-52 Homolog (SMU1) (AA 1-513) antibodySMU1 Reaktivität: Human WB, IF Wirt: Maus Polyclonal unconjugated
anti-Smu-1 Suppressor of Mec-8 and Unc-52 Homolog (SMU1) (AA 1-513) antibodySMU1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Smu-1 Suppressor of Mec-8 and Unc-52 Homolog (SMU1) (AA 1-220) antibodySMU1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Smu-1 Suppressor of Mec-8 and Unc-52 Homolog (SMU1) (AA 107-156) antibodySMU1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen, Zebrafisch (Danio rerio), Huhn, Hamster, Affe, Schwein, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-Smu-1 Suppressor of Mec-8 and Unc-52 Homolog (SMU1) (N-Term) antibodySMU1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen, Zebrafisch (Danio rerio) WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SMU1 Blocking Peptide, catalog no. 33R-4615, is also available for use as a blocking control in assays to test for specificity of this SMU1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMU1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SMU1 (Smu-1 Suppressor of Mec-8 and Unc-52 Homolog (SMU1))
- Andere Bezeichnung
- SMU1 (SMU1 Produkte)
- Hintergrund
- SMU1 acts a s a suppressor of mec-8 and unc-52 homolog.
- Molekulargewicht
- 57 kDa (MW of target protein)
-
Sie sind hier:
