SMU1 Antikörper

Produktnummer ABIN632943

Dieses Anti-SMU1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von SMU1 in WB. Geeignet für Human.

Kurzübersicht für SMU1 Antikörper (ABIN632943)

Target: SMU1 (Smu-1 Suppressor of Mec-8 and Unc-52 Homolog (SMU1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SMU1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SMU1 Antikörper

Aufreinigung: Affinity purified

Immunogen: SMU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KQTQPERYIHLENLLARSYFDPREAYPDGSSKEKRRAAIAQALAGEVSVV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SMU1 Blocking Peptide, (ABIN940001), is also available for use as a blocking control in assays to test for specificity of this SMU1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMU1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SMU1

Target: SMU1 (Smu-1 Suppressor of Mec-8 and Unc-52 Homolog (SMU1))

Andere Bezeichnung: SMU1

Hintergrund: SMU1 acts a s a suppressor of mec-8 and unc-52 homolog.

Molekulargewicht: 57 kDa (MW of target protein)